<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
MZ-pt32 pt32-t0 Italy 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT NA
2 AZT+ DDC NA
3 3TC+ D4T NA
4 3TC+ D4T+ SQV NA
5 3TC+ D4T+ IDV NA
6 D4T+ IDV+ NVP NA
7 D4T+ NFV+ NVP NA
8 None NA
9 ABC+ DDI+ RTV+ SQV NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L210W, T215Y D67E, V75M Y181C, G190A   V35I, K43E, E44D, S68G, V118I, K122P, I135T, A158S, D177E, V179I, T200E, I202V, E203K, Q207E, R211K  
>pt32-t0| codons 1-230
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALIEICTELEEDGKISKIGPENPYNTPV
FAIKKKEGTKWRKLMDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DPDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPSIFQSSMTKILEPFRKQNPEIII
CQYMDDLYVASDLEIGQHREKVKELREHLWKWGFYTPDKKHQKEPPFLWM

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, G48V, V82C, L90M Q58E L10I, I62V, L63P, I64L, A71T, V77I, I93L  
>pt32-t0| codons 1-99
PQITLWQRPIVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKLIVGIGGFIKVREYD
QVPLEICGHKTIGTVLIGPTPCNIIGRNLMTQLGCTLNF

References
Author Title Citation
Romano, L Treatment with lopinavir/ritonavir in heavily pretreated subjects failing multiple antiretroviral regimens in clinical practice. JAIDS, 2002
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005