<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
MZ-pt16 pt16-t0 Italy 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+ DDC NA
2 3TC+ AZT NA
3 3TC+ AZT+ SQV NA
4 3TC+ AZT+ RTV+ SQV NA
5 3TC+ AZT+ NFV NA
6 D4T+ DDI+ NFV NA
7 DDI+ EFV+ RTV NA
8 ABC+ DDI+ EFV NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L74V, L210W, T215Y K219N Y181C, Y188L V179D K43Q, K49R, V60VI, K103R, I135T, I202V, R211K  
>pt16-t0| codons 1-230
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEQEGKISRIGPENPYNTPI
FAIKKKNSTKWRKVVDFRELNKRTQDFWEVQLGIPHPAGLKKRKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIDI
CQYMDDLLVGSDLEIGQHRTKVEELRQHLWKWGFYTPDNKHQKEPPFLWM

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, L90M Q58E, G73A L10I, N37D, I62V, L63P, I64L, A71T, I72IV, V77I, I93L  
>pt16-t0| codons 1-99
PQITLWQRPIVTIKIGGQLKEALLDTGADDTVLEEMDLPGRWKPKIIGGIGGFIKVREYD
QVPLEICGHKTVATVLIGPTPVNIIGRNLMTQLGCTLNF

References
Author Title Citation
Romano, L Treatment with lopinavir/ritonavir in heavily pretreated subjects failing multiple antiretroviral regimens in clinical practice. JAIDS, 2002
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005