<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
MZ-pt31 pt31-t0 Italy 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+ DDC NA
2 3TC+ AZT NA
3 3TC+ D4T+ IDV NA
4 DDI+ NVP+ RTV+ SQV NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
G48V, I54V, V82C, I84V Q58E L10I, E35D, M36I, D60E, I62V, L63P, H69N, A71V, V77I, I93M  
>pt31-t0| codons 1-99
PQITLWQRPIVTIKIGGQLKEALLDTGADDTVLEDINLPGRWKPKMIVGIGGFVKVREYE
QVPIEICGNKVIGTVLIGPTPCNVIGRNLLTQMGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
L210W, T215Y K219E Y181C K101N V35I, T39A, E40K, K43E, V60I, R83K, V118I, V179L, R211K, D218E  
>pt31-t0| codons 1-230
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALIEICAKMEEEGKISKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKKTQDFWEVQLGIPHPAGLNKKKSVTVLDVGDAYFSIPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDILI
CQYMDDLYVGSDLEIGQHRTKIEELRQHLWKWGFYTPEEKHQKEPPFLWM

References
Author Title Citation
Romano, L Treatment with lopinavir/ritonavir in heavily pretreated subjects failing multiple antiretroviral regimens in clinical practice. JAIDS, 2002
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005