<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
MZ-pt9 pt9-t1 Italy 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT NA
2 AZT+ DDI NA
3 AZT+ DDC NA
4 3TC+ DDI+ IDV NA
5 D4T+ DDI+ IDV NA
6 EFV+ IDV NA
7 3TC+ D4T+ RTV NA
8 3TC+ D4T+ RTV+ SQV NA
9 D4T+ DDI+ NFV+ NVP NA
10 3TC+ D4T+ NFV+ NVP NA
11 ABC+ D4T+ NFV+ NVP NA
12 3TC+ ABC+ D4T NA
13 3TC+ ABC+ D4T+ IDV NA
14 3TC+ ABC+ D4T+ LPV NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54V, V82T L24I L10I, I13L, L19I, N37Y, R57K, I62V, L63P, I64M, I66F, A71V, I72V, V77I  
>pt9-t1| codons 1-99
PQITLWQRPIVTLKIGGQIKEALIDTGADDTVLEEMYLPGRWKPKLIGGIGGFVKVKQYD
QVPMEFCGHKVVGTVLIGPTPTNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, M184V, L210W, T215Y K219R G190GS K101H V35L, T39A, E44D, V106I, V118I, K122E, D123N, I135T, S162D, Q174K, Q197K, T200A, I202V, Q207D, H208Y, H221Y  
>pt9-t1| codons 1-230
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALLEICAELEKDGKISKIGPENPYNTPV
FAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLHKKKSITVLDVGDAYFSIPL
DENFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQDSMTKILEPFRKKNPDIVI
YQYVDDLYVSSDLEIGKHRAKVEELRDYLWRWGFYTPDRKYQKEPPFLWM

References
Author Title Citation
Romano, L Treatment with lopinavir/ritonavir in heavily pretreated subjects failing multiple antiretroviral regimens in clinical practice. JAIDS, 2002
Gonzales, MJ Protease and reverse transcriptase mutation patterns in HIV-1 isolates from heavily treated persons: Comparison of isolates from northern California with isolates from other regions. ARHR, 2003
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005