Isolate Data
| Patient | Isolate | Region | Year | Species | Subtype | Source | Clone Method |
| MZ-pt9 | pt9-t1 | Italy | 2001 | HIV1 | B | Plasma | None |
Treatment History
| Order | Regimen | Weeks |
| 1 | AZT | NA |
| 2 | AZT+ DDI | NA |
| 3 | AZT+ DDC | NA |
| 4 | 3TC+ DDI+ IDV | NA |
| 5 | D4T+ DDI+ IDV | NA |
| 6 | EFV+ IDV | NA |
| 7 | 3TC+ D4T+ RTV | NA |
| 8 | 3TC+ D4T+ RTV+ SQV | NA |
| 9 | D4T+ DDI+ NFV+ NVP | NA |
| 10 | 3TC+ D4T+ NFV+ NVP | NA |
| 11 | ABC+ D4T+ NFV+ NVP | NA |
| 12 | 3TC+ ABC+ D4T | NA |
| 13 | 3TC+ ABC+ D4T+ IDV | NA |
| 14 | 3TC+ ABC+ D4T+ LPV | NA |
Protease Sequence
| PIMajorDRMs | PIMinorDRMs | Polys | UnusualMuts |
| M46L, I54V, V82T | L24I | L10I, I13L, L19I, N37Y, R57K, I62V, L63P, I64M, I66F, A71V, I72V, V77I |
| >pt9-t1| codons 1-99 PQITLWQRPIVTLKIGGQIKEALIDTGADDTVLEEMYLPGRWKPKLIGGIGGFVKVKQYD QVPMEFCGHKVVGTVLIGPTPTNIIGRNLLTQIGCTLNF |
RT Sequence
| NRTIMajorDRMs | NRTIMinorDRMs | NNRTIMajorDRMs | NNRTIMinorDRMs | Polys | UnusualMuts |
| M41L, D67N, M184V, L210W, T215Y | K219R | G190GS | K101H | V35L, T39A, E44D, V106I, V118I, K122E, D123N, I135T, S162D, Q174K, Q197K, T200A, I202V, Q207D, H208Y, H221Y |
| >pt9-t1| codons 1-230 PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALLEICAELEKDGKISKIGPENPYNTPV FAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLHKKKSITVLDVGDAYFSIPL DENFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQDSMTKILEPFRKKNPDIVI YQYVDDLYVSSDLEIGKHRAKVEELRDYLWRWGFYTPDRKYQKEPPFLWM |
References
| Author | Title | Citation |
| Romano, L | Treatment with lopinavir/ritonavir in heavily pretreated subjects failing multiple antiretroviral regimens in clinical practice. | JAIDS, 2002 |
| Gonzales, MJ | Protease and reverse transcriptase mutation patterns in HIV-1 isolates from heavily treated persons: comparison of isolates from northern California with isolates from other regions. | ARHR, 2003 |
| Rhee, SY | HIV-1 Protease and Reverse Transcriptase Mutations: Correlations with Antiretroviral Therapy in Subtype B Isolates and Implications for Drug-Resistance Surveillance. | J Infect Dis, 2005 |
