<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1269 CA3046 U.S. 1997 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 69
2 AZT+DDI 109
3 D4T 13
4 DDC 35
5 3TC+DDC 9
6 3TC+DDI+SQV 18
7 3TC+DDI+IDV 35

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, T69D, K70R, M184V K219Q     K104N, K122E, T200A, I202V, L228H, I257T  
>CA3046| codons 1-274
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKNSDRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKNSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRAKVEELRQHLLRWGFTTPDQKHQKEPPFHWMGYELHPDKWT
VQPIVLPEKDSWTVNDTQKLVGKLNWASQIYAGI

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10I, I13V, L19I, K43R, L63P, I64V, E65D  
>CA3047| codons 1-99
PQITLWQRPIVTVKIGGQIKEALLDTGADDTVLEEMNLPGRWRPKMIGGIGGFIKVRQYD
QIPVDICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Gonzales, MJ Extended spectrum of HIV-1 reverse transcriptase mutations in patients receiving multiple nucleoside analog inhibitors. AIDS, 2003
Gonzales, MJ Protease and reverse transcriptase mutation patterns in HIV-1 isolates from heavily treated persons: Comparison of isolates from northern California with isolates from other regions. ARHR, 2003
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005