<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
MZ-pt8 pt8-t1 Italy 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT NA
2 AZT+ DDC NA
3 3TC+ D4T+ SQV NA
4 3TC+ D4T+ IDV NA
5 D4T+ DDI+ EFV+ NFV NA
6 D4T+ EFV+ NFV NA
7 D4T+ DDI+ IDV+ NFV NA
8 D4T+ DDI+ NFV NA
9 ABC+ D4T+ DDI NA
10 3TC+ ABC+ DDI NA
11 3TC+ D4T+ APV NA
12 D4T+ DDI NA
13 3TC+ AZT+ LPV NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L74V, L210W, T215Y K219N L100I, K103N   K20R, V35I, K43N, E44D, V118I, K122E, D177G, H208Y, R211K, D218E  
>pt8-t1| codons 1-230
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALIEICTELENDGKISKIGPENPYNTPV
FAIKKKNSTKWRKVVDFRELNKRTQDFWEVQLGIPHPAGIKKNKSVTVLDVGDAYFSIPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPGIVI
YQYMDDLYVGSDLEIGQHRTKIEELRQYLWKWGFYTPENKHQKEPPFLWM

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, V82A, L90M L33I, Q58E, G73S L10I, K20R, E35D, M36I, R41K, K55R, I62V, L63P, A71V  
>pt8-t1| codons 1-99
PQITLWQRPIVTIKIGGQLREALLDTGADDTVIEDINLPGKWKPKMIGGIGGFVRVREYD
QVPIEICGHKVISTVLVGPTPANIIGRNLMTQIGCTLNF

References
Author Title Citation
Romano, L Treatment with lopinavir/ritonavir in heavily pretreated subjects failing multiple antiretroviral regimens in clinical practice. JAIDS, 2002
Gonzales, MJ Protease and reverse transcriptase mutation patterns in HIV-1 isolates from heavily treated persons: Comparison of isolates from northern California with isolates from other regions. ARHR, 2003
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005