<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
MZ-pt14 pt14-t1 Italy 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT NA
2 DDI NA
3 AZT+ DDC NA
4 3TC+ DDC NA
5 3TC+ D4T+ SQV NA
6 3TC+ D4T+ IDV NA
7 3TC+ D4T+ NFV+ SQV NA
8 D4T+ DDI+ EFV NA
9 ABC+ D4T+ DDI NA
10 D4T+ DDI NA
11 APV+ D4T+ DDI+ RTV NA
12 D4T+ DDI+ LPV NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54V, V82A, L90M L33F, Q58E, G73S L10V, I13V, K20R, E35D, M36I, N37E, D60E, I62V, L63P, A71V, I72E  
>pt14-t1| codons 1-99
PQITLWQRPVVTVKIGGQLREALLDTGADDTVFEDIELPGRWKPKLIGGIGGFVKVREYE
QVPIEICGHKVESTVLVGPTPANIIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, M184I, L210W, T215Y K219R     K20R, V35T, T39A, E44D, V118I, D123E, S162D, K166R, D177G, E203K, Q207D, H208Y, R211K, K223E, E224D  
>pt14-t1| codons 1-230
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALTEICAELEKDGKISKIGPENPYNTPV
FAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQDSMTRILEPFRKQNPGIVI
YQYIDDLYVGSDLEIGQHRTKIKELRDYLWKWGFYTPDRKHQEDPPFLWM

References
Author Title Citation
Romano, L Treatment with lopinavir/ritonavir in heavily pretreated subjects failing multiple antiretroviral regimens in clinical practice. JAIDS, 2002
Gonzales, MJ Protease and reverse transcriptase mutation patterns in HIV-1 isolates from heavily treated persons: Comparison of isolates from northern California with isolates from other regions. ARHR, 2003
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005