<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
MZ-pt13 pt13-t1 Italy 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+ DDC NA
2 SQV NA
3 3TC+ D4T+ IDV NA
4 D4T+ DDI+ EFV+ RTV NA
5 D4T+ IDV+ RTV NA
6 3TC+ APV+ D4T+ DDI NA
7 D4T+ DDI+ EFV+ LPV NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, V82VA, I84V, L90M L33F L10I, I13V, L19I, N37D, K55KR, I62V, L63P, C67F, A71V, I72L, Q92R  
>pt13-t1| codons 1-99
PQITLWQRPIVTVKIGGQIKEALLDTGADDTVFEEMDLPGRWKPKMIGGIGGFVRVRQYD
QVPIEIFGHKVLGTVLVGPTPANVIGRNLMTRIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41ML, D67DN, K70KR, L74LI, M184MI, T215TFIS K219KE Y181YC   K20KR, V35I, V118VI, K122KQ, S134SG, Q174E, F214L N137ND
>pt13-t1| codons 1-230
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALIEICTELEKEGKISKIGPENPYNTPV
FAIKKKNSTRWRKIVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DQDFRKYTAFTIPGINDETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKENPDIVI
CQYIDDLYVGSDLEIGQHRTKIEELRQHLLRWGLSTPDEKHQKEPPFLWM

References
Author Title Citation
Romano, L Treatment with lopinavir/ritonavir in heavily pretreated subjects failing multiple antiretroviral regimens in clinical practice. JAIDS, 2002
Gonzales, MJ Protease and reverse transcriptase mutation patterns in HIV-1 isolates from heavily treated persons: Comparison of isolates from northern California with isolates from other regions. ARHR, 2003
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005