<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
MZ-pt13 pt13-t0 Italy 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+ DDC NA
2 SQV NA
3 3TC+ D4T+ IDV NA
4 D4T+ DDI+ EFV+ RTV NA
5 D4T+ IDV+ RTV NA
6 3TC+ APV+ D4T+ DDI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, I84V, L90M L33F L10I, I13V, L19LI, N37D, I62V, L63P, C67F, A71V, I72L, Q92R  
>pt13-t0| codons 1-99
PQITLWQRPIVTVKIGGQIKEALLDTGADDTVFEEMDLPGRWKPKMIGGIGGFVKVRQYD
QVPIEIFGHKVLGTVLVGPTPVNVIGRNLMTRIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70R, L74I, M184I, T215F K219Q     V35I, S117A, V118I, Q174E, F214L, D218E  
>pt13-t0| codons 1-230
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALIEICTELEKEGKISKIGPENPYNTPV
FAIKKKNSTRWRKIVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFAIPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKENPDIVI
YQYIDDLYVGSDLEIGQHRTKIEELRQHLLRWGLFTPEQKHQKEPPFLWM

References
Author Title Citation
Romano, L Treatment with lopinavir/ritonavir in heavily pretreated subjects failing multiple antiretroviral regimens in clinical practice. JAIDS, 2002
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005