<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
MZ-pt6 pt6-t0 Italy 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT NA
2 AZT+ DDI NA
3 AZT+ DDC NA
4 3TC+ AZT NA
5 3TC+ AZT+ SQV NA
6 3TC+ D4T+ IDV NA
7 D4T+ NFV+ NVP NA
8 D4T+ EFV+ NVP NA
9 ABC+ D4T+ IDV+ RTV NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L74LI, L210W, T215Y V75M, K219N K103KN, Y181C, G190E   K43E, E44A, V118I, K122E, V179G, T200K, R211K, L228H  
>pt6-t0| codons 1-230
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEEAGKISKIGPENPYNTPV
FAIKKKDSTKWRKIMDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSIPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIGI
CQYMDDLYVESDLEIGQHRKKIEELRQHLWKWGFYTPDNKHQKEPPFHWM

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32VI, M46MI, I54IV, V82A, L90M K43KT L10I, K20KR, E35D, M36I, N37ND, K55KR, L63P, Q92K  
>pt6-t0| codons 1-99
PQITLWQRPIVTIKIGGQLREALLDTGADDTILEDIDLPGRWTPKIIGGIGGFVRVRQYD
QIPIEICGHKAIGTVLVGPTPANIIGRNLMTKIGCTLNF

References
Author Title Citation
Romano, L Treatment with lopinavir/ritonavir in heavily pretreated subjects failing multiple antiretroviral regimens in clinical practice. JAIDS, 2002
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005