<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
MZ-pt12 pt12-t0 Italy 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT NA
2 AZT+ DDC+ RTV NA
3 3TC+ AZT+ IDV NA
4 D4T+ RTV+ SQV NA
5 D4T+ EFV+ NFV NA
6 D4T+ RTV+ SQV NA
7 D4T+ DDI+ IDV+ RTV NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, V82T, L90M G73S L10I, I15V, I62IV, L63P, C67CF, A71V, I85V  
>pt12-t0| codons 1-99
PQITLWQRPIVTIKVGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFVKVRQYD
QVPIEIFGHKVISTVLVGPTPTNIVGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
T69D, K70R D67G, K219Q K103N   P4S, K20R, T39A, S68G, D123E, I135T  
>pt12-t0| codons 1-230
PISSIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICAEMEKEGKISKIGPENPYNTPV
FAIKKKGGDRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGFTTPDQKHQKEPPFLWM

References
Author Title Citation
Romano, L Treatment with lopinavir/ritonavir in heavily pretreated subjects failing multiple antiretroviral regimens in clinical practice. JAIDS, 2002
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005