<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
MZ-pt5 pt5-t0 Italy 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT NA
2 AZT+ DDC NA
3 AZT+ DDC+ SQV NA
4 3TC+ AZT+ SQV NA
5 D4T+ RTV+ SQV NA
6 D4T+ EFV+ IDV+ RTV NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, I84V, L90M G73T L10LI, K20I, M36I, D60E, I62V, L63P, C67F, A71V  
>pt5-t0| codons 1-99
PQITLWQRPIVTIKIGGQLIEALLDTGADDTVLEEINLPGRWKPKMIGGIGGFVKVRQYE
QVPIEIFGHKVITTVLVGPTPVNVIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67DN, V75M, L210W, T215Y   K103N   K43N, K122E, T139M, S162Y, E169ED, D177E, Q207E P19PQ
>pt5-t0| codons 1-230
PISPIETVPVKLKPGMDGQKVKQWPLTEEKIKALVEICTELENEGKISKIGPENPYNTPV
FAIKKKNSTKWRKLMDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNEMPGIRYQYNVLPQGWKGSPAIFQYSMTKILDPFRKQNPEIVI
YQYMDDLYVGSDLEIGQHRTKIEELREHLWRWGFYTPDKKHQKEPPFLWM

References
Author Title Citation
Romano, L Treatment with lopinavir/ritonavir in heavily pretreated subjects failing multiple antiretroviral regimens in clinical practice. JAIDS, 2002
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005