<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
MZ-pt11 pt11-t0 Italy 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+ DDI NA
2 AZT+ DDI+ NVP NA
3 3TC+ AZT+ IDV NA
4 3TC+ IDV+ SQV NA
5 3TC+ EFV+ SQV NA
6 3TC+ EFV+ NFV NA
7 DDI+ NFV NA
8 D4T+ NFV NA
9 AZT+ DDC+ SQV NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K65KR, D67N, T69D, K70R, Q151QKLM, T215F F116FY, K219KE K101E, K103KN, Y181YC, G190A   V90I, A98S, K102R, K122KE, E169D, E194ED, G196E, Q207AE  
>pt11-t0| codons 1-230
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKRKNSDRWRKLVDFRELNKRTQDFWEIQLGIPHPSGLERNKSVTVLDVGDAYYSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPMGWKGSPAIFQSSMTKILDPFRKQNPDIVI
CQYMDDLYVASDLDIEQHRTKIEELREHLLRWGFFTPDEKHQKEPPFLWM

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, M46I, V82A, L90M K43KT L10I, L63P, I66F, A71V, I72V  
>pt11-t0| codons 1-99
PQITLWQRPIVTIKIGGQLKEALLDTGADDTILEEMNLPGRWTPKIIGGIGGFIKVRQYD
QIPIEFCGHKVVGTVLVGPTPANIIGRNLMTQIGCTLNF

References
Author Title Citation
Romano, L Treatment with lopinavir/ritonavir in heavily pretreated subjects failing multiple antiretroviral regimens in clinical practice. JAIDS, 2002
Gonzales, MJ Protease and reverse transcriptase mutation patterns in HIV-1 isolates from heavily treated persons: Comparison of isolates from northern California with isolates from other regions. ARHR, 2003
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005