<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
MZ-pt4 pt4-t0 Italy 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 DDI NA
2 AZT NA
3 AZT+ DDC NA
4 3TC+ D4T NA
5 3TC+ D4T+ IDV NA
6 3TC+ D4T+ SQV NA
7 3TC+ D4T+ RTV+ SQV NA
8 D4T+ DDI+ NFV NA
9 D4T+ DDI+ EFV NA
10 None NA
11 D4T+ DDI+ RTV+ SQV NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46ML, I84V, L90M   L10I, K20R, E35D, M36I, N37ND, R57K, D60DE, L63P, I64V, V77I  
>pt4-t0| codons 1-99
PQITLWQRPIVTIKIGGQLREALLDTGADDTVLEDIDLPGRWKPKLIGGIGGFIKVKQYE
QIPVEICGHKAIGTVLIGPTPVNVIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67DN, M184MI, L210LW, T215Y       K43N, V118I, D123E, I135IV, Q207E, H208Y, R211K, K223E  
>pt4-t0| codons 1-230
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELENEGKISKIGPENPYNTPV
FAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DKEFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYIDDLYVGSDLEIGQHRTKIEELREYLWKWGFYTPDKKHQEEPPFLWM

References
Author Title Citation
Romano, L Treatment with lopinavir/ritonavir in heavily pretreated subjects failing multiple antiretroviral regimens in clinical practice. JAIDS, 2002
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005