<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
MZ-pt10 pt10-t0 Italy 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT NA
2 AZT+ DDI NA
3 AZT+ DDI+ SQV NA
4 3TC+ AZT+ SQV NA
5 3TC+ D4T+ IDV NA
6 AZT+ EFV+ IDV NA
7 ABC+ EFV+ NVP NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L74V, M184V, T215Y   K101P, K103N   P4S, K20R, R83K, D123E, V189I  
>pt10-t0| codons 1-230
PISSIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKVVDFRELNKKTQDFWEVQLGIPHPAGLPKNKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYIGSDLEIGQHRTKIEELRQHLLRWGFYTPDKKHQKEPPFLWM

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
L90M   R41K, L63P, H69I, K70R, A71V, I72T, I93L  
>pt10-t0| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGKWKPKMIGGIGGFIKVRQYD
QIPIEICGIRVTGTVLVGPTPVNIIGRNLMTQLGCTLNF

References
Author Title Citation
Romano, L Treatment with lopinavir/ritonavir in heavily pretreated subjects failing multiple antiretroviral regimens in clinical practice. JAIDS, 2002
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005