<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
MZ-pt3 pt3-t0 Italy 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT NA
2 AZT+ DDI NA
3 AZT+ DDC NA
4 AZT+ DDI+ IDV NA
5 AZT+ IDV NA
6 3TC+ AZT+ SQV NA
7 D4T+ RTV+ SQV NA
8 D4T+ EFV+ NFV NA
9 3TC+ D4T+ NFV NA
10 D4T+ DDI+ NFV NA
11 D4T+ NVP+ RTV+ SQV NA
12 D4T+ DDI+ NVP NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, L90M Q58E, G73S I13V, I15V, K20T, R41K, D60E, Q61D, L63P, I64V, A71V, V77I, I93L  
>pt3-t0| codons 1-99
PQITLWQRPLVTVKVGGQLTEALLDTGADDTVLEEMNLPGKWKPKIIGGIGGFIKVREYE
DIPVEICGHKVISTVLIGPTPVNIIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L210W, T215Y   K103N, Y181C   V35I, K43Q, K122E, A158S, E169D, G196E, I202V, R211K  
>pt3-t0| codons 1-230
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALIEICTELEQEGKISKIGPENPYNTPV
FAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPSIFQSSMTKILDPFRKQNPDIVI
CQYMDDLYVGSDLEIEQHRTKVEELRQHLWKWGFYTPDKKHQKEPPFLWM

References
Author Title Citation
Romano, L Treatment with lopinavir/ritonavir in heavily pretreated subjects failing multiple antiretroviral regimens in clinical practice. JAIDS, 2002
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005