<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
MZ-pt2 pt2-t0 Italy 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+ DDC+ SQV NA
2 3TC+ AZT+ NFV NA
3 D4T+ DDI+ NFV NA
4 ABC+ D4T+ DDI NA
5 ABC+ D4T+ DDI+ NVP NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, L90M   L10I, T12P, I13V, K20I, D60E, L63P, C67D, A71T, I72V, T74S, V77I  
>pt2-t0| codons 1-99
PQITLWQRPIVPVKIGGQLIEALLDTGADDTVLEEMNLPGRWKPKIIGGIGGFIKVRQYE
QIPIEIDGHKTVGSVLIGPTPVNIIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70R, V75T, Q151QKLM, L210W, T215Y K219D K101KE, Y181C, G190A F227L V118VI, K122E, D123E, I135T, S162C, D177E, D218E, L228H Q222K
>pt2-t0| codons 1-230
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPV
FAIKKKNSTRWRKLTDFRELNKRTQDFWEVQLGIPHPAGLEKKKSVTVLDVGDAYFSIPL
DEEFRKYTAFTIPSTNNETPGIRYQYNVLPMGWKGSPAIFQCSMTKILEPFRKQNPEIVI
CQYMDDLYVASDLEIGQHRTKIEELRQHLWRWGFYTPEDKHKKEPPLHWM

References
Author Title Citation
Romano, L Treatment with lopinavir/ritonavir in heavily pretreated subjects failing multiple antiretroviral regimens in clinical practice. JAIDS, 2002
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005