Isolate Data
| Patient | Isolate | Region | Year | Species | Subtype | Source | Clone Method |
| MZ-pt1 | pt1-t1 | Italy | 2001 | HIV1 | B | Plasma | None |
Treatment History
| Order | Regimen | Weeks |
| 1 | AZT | NA |
| 2 | AZT+ DDC | NA |
| 3 | D4T | NA |
| 4 | 3TC+ AZT+ IDV | NA |
| 5 | 3TC+ AZT+ SQV | NA |
| 6 | 3TC+ AZT+ NFV+ SQV | NA |
| 7 | DDI+ EFV+ RTV | NA |
| 8 | AZT+ DDI+ RTV | NA |
| 9 | DDI+ NFV+ SQV | NA |
| 10 | ABC+ ADV+ DDC+ NFV+ SQV | NA |
| 11 | 3TC+ ABC+ APV+ DDI+ NFV | NA |
| 12 | 3TC+ ABC+ APV+ D4T | NA |
| 13 | 3TC+ D4T+ LPV | NA |
RT Sequence
| NRTIMajorDRMs | NRTIMinorDRMs | NNRTIMajorDRMs | NNRTIMinorDRMs | Polys | UnusualMuts |
| M41L, D67N, T69D, K70R, L74V, M184MV, T215F | K219W | L100I, K103N | P4S, K20R, V35I, T39A, K43E, V60I, A98S, K122E, I135V, I167V, V179I, G196E, H208Y, R211K, D218E, L228H |
| >pt1-t1| codons 1-230 PISSIETVPVKLKPGMDGPRVKQWPLTEEKIKALIEICAELEEEGKISKIGPENPYNTPI FAIKKKNSDRWRKVVDFRELNKRTQDFWEVQLGIPHPSGIKKNKSVTVLDVGDAYFSVPL DEDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKVLEPFRKQNPDIII YQYVDDLYVGSDLEIEQHRTKIEELRQYLLKWGFFTPEWKHQKEPPFHWM |
Protease Sequence
| PIMajorDRMs | PIMinorDRMs | Polys | UnusualMuts |
| I54V, V82A, I84V | L24I, L33F, K43T, L89V | L10I, T12S, I13V, K20T, T31S, E35D, M36L, I62V, L63P, A71I, I72V, Q92K |
| >pt1-t1| codons 1-99 PQITLWQRPIVSVKIGGQLTEALIDTGADDSVFEDLNLPGRWTPKMIGGIGGFVKVRQYD QVPIEICGHKIVGTVLVGPTPANVIGRNVLTKIGCTLNF |
References
| Author | Title | Citation |
| Romano, L | Treatment with lopinavir/ritonavir in heavily pretreated subjects failing multiple antiretroviral regimens in clinical practice. | JAIDS, 2002 |
| Gonzales, MJ | Protease and reverse transcriptase mutation patterns in HIV-1 isolates from heavily treated persons: comparison of isolates from northern California with isolates from other regions. | ARHR, 2003 |
| Rhee, SY | HIV-1 Protease and Reverse Transcriptase Mutations: Correlations with Antiretroviral Therapy in Subtype B Isolates and Implications for Drug-Resistance Surveillance. | J Infect Dis, 2005 |