<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
MZ-pt1 pt1-t0 Italy 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT NA
2 AZT+ DDC NA
3 D4T NA
4 3TC+ AZT+ IDV NA
5 3TC+ AZT+ SQV NA
6 3TC+ AZT+ NFV+ SQV NA
7 DDI+ EFV+ RTV NA
8 AZT+ DDI+ RTV NA
9 DDI+ NFV+ SQV NA
10 ABC+ ADV+ DDC+ NFV+ SQV NA
11 3TC+ ABC+ APV+ DDI+ NFV NA
12 3TC+ ABC+ APV+ D4T NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, V82A, I84IV L24I, L33LF, K43KT, L89LV L10I, T12S, K20KT, E35D, M36MI, I62V, L63P, A71I, I72V, V77VI  
>pt1-t0| codons 1-99
PQITLWQRPIVSIKIGGQLTEALIDTGADDTVFEDINLPGRWTPKMIGGIGGFVKVRQYD
QVPIEICGHKIVGTVLIGPTPANVIGRNVLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, K70R, L74V, T215F K219Q L100I, K103N   P4PS, T39A, V60I, A98S, K122E, I135V, I167V, V179I, G196E, H208Y, R211K, L228H D218V
>pt1-t0| codons 1-230
PISSIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICAELEKEGKISKIGPENPYNTPI
FAIKKKNSDRWRKVVDFRELNKRTQDFWEVQLGIPHPSGIKKNKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKVLEPFRKQNPDIII
YQYMDDLYVGSDLEIEQHRTKIEELRQYLLKWGFFTPVQKHQKEPPFHWM

References
Author Title Citation
Romano, L Treatment with lopinavir/ritonavir in heavily pretreated subjects failing multiple antiretroviral regimens in clinical practice. JAIDS, 2002
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005