<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
MZ-pt28 pt28-t1 Italy 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT NA
2 DDI NA
3 AZT+ DDC NA
4 AZT+ DDC+ IDV NA
5 3TC+ AZT+ SQV NA
6 D4T+ DDI+ EFV+ NFV NA
7 D4T+ EFV+ NFV NA
8 D4T+ DDI+ RTV+ SQV NA
9 D4T+ DDI+ LPV NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, L210W, T215Y   K103N A98G T27S, V35VI, K43KE, V118VI, D123E, I135T, H208FY, R211K  
>pt28-t1| codons 1-230
PISPIETVPVKLKPGMDGPKVKQWPLSEEKIKALIEICTELEEEGKISKIGPENPYNTPV
FAIKKKNSDKWRKLVDFRELNKRTQDFWEVQLGIPHPGGLKKNKSVTVLDVGDAYFSIPL
DKEFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELRQYLWKWGFYTPDKKHQKEPPFLWM

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54V, V82A, L90M K43T L10IV, E35D, M36I, N37DE, L63P, A71V, I72V, I93L  
>pt28-t1| codons 1-99
PQITLWQRPVVTIKIGGQLKEALLDTGADDTVLEDIELPGRWTPKLIGGIGGFVKVRQYD
QIPIEICGHKVVGTVLVGPTPANIIGRNLMTQLGCTLNF

References
Author Title Citation
Romano, L Treatment with lopinavir/ritonavir in heavily pretreated subjects failing multiple antiretroviral regimens in clinical practice. JAIDS, 2002
Gonzales, MJ Protease and reverse transcriptase mutation patterns in HIV-1 isolates from heavily treated persons: Comparison of isolates from northern California with isolates from other regions. ARHR, 2003
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005