Isolate Data
| Patient | Isolate | Region | Year | Species | Subtype | Source | Clone Method |
| MZ-pt27 | pt27-t1 | Italy | 2001 | HIV1 | B | Plasma | None |
Treatment History
| Order | Regimen | Weeks |
| 1 | AZT | NA |
| 2 | AZT+ DDC | NA |
| 3 | 3TC+ AZT+ RTV | NA |
| 4 | 3TC+ AZT+ IDV | NA |
| 5 | D4T+ EFV+ NFV | NA |
| 6 | 3TC+ AZT+ RTV+ SQV | NA |
| 7 | 3TC+ AZT+ IDV | NA |
| 8 | ABC+ AZT+ DDI | NA |
| 9 | ABC+ AZT+ DDC | NA |
| 10 | 3TC+ ABC+ AZT | NA |
| 11 | APV+ D4T+ DDC+ RTV | NA |
| 12 | None | NA |
| 13 | DDI+ LPV | NA |
Protease Sequence
| PIMajorDRMs | PIMinorDRMs | Polys | UnusualMuts |
| I54IV, V82A | L24I, L33F, G73GS | L10I, K20R, E21ED, E35D, M36I, N37D, I62V, L63P, A71V |
| >pt27-t1| codons 1-99 PQITLWQRPIVTIKIGGQLRDALIDTGADDTVFEDIDLPGRWKPKMIGGIGGFVKVRQYD QVPIEICGHKVISTVLVGPTPANIIGRNLLTQIGCTLNF |
RT Sequence
| NRTIMajorDRMs | NRTIMinorDRMs | NNRTIMajorDRMs | NNRTIMinorDRMs | Polys | UnusualMuts |
| M41L, D67N, T69D, V75M, Y115YF, M184MV, L210W, T215Y | F77L | V21I, V35I, T39A, K43E, E44D, K49R, E53D, K101Q, V118I, K122E, E169D, G196E, D218E |
| >pt27-t1| codons 1-230 PISPIETVPVKLKPGMDGPKIKQWPLTEEKIKALIEICAELEEDGKISRIGPDNPYNTPV FAIKKKNSDKWRKLMDLRELNKRTQDFWEVQLGIPHPAGLQKKKSVTVLDVGDAFFSIPL DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILDPFRKQNPDIVI YQYVDDLYVGSDLEIEQHRTKIEELRQHLWRWGFYTPEKKHQKEPPFLWM |
References
| Author | Title | Citation |
| Romano, L | Treatment with lopinavir/ritonavir in heavily pretreated subjects failing multiple antiretroviral regimens in clinical practice. | JAIDS, 2002 |
| Gonzales, MJ | Protease and reverse transcriptase mutation patterns in HIV-1 isolates from heavily treated persons: comparison of isolates from northern California with isolates from other regions. | ARHR, 2003 |
| Rhee, SY | HIV-1 Protease and Reverse Transcriptase Mutations: Correlations with Antiretroviral Therapy in Subtype B Isolates and Implications for Drug-Resistance Surveillance. | J Infect Dis, 2005 |
