<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
MZ-pt27 pt27-t0 Italy 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT NA
2 AZT+ DDC NA
3 3TC+ AZT+ RTV NA
4 3TC+ AZT+ IDV NA
5 D4T+ EFV+ NFV NA
6 3TC+ AZT+ RTV+ SQV NA
7 3TC+ AZT+ IDV NA
8 ABC+ AZT+ DDI NA
9 ABC+ AZT+ DDC NA
10 3TC+ ABC+ AZT NA
11 APV+ D4T+ DDC+ RTV NA
12 None NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, V75M, M184V, L210W, T215Y F77L     V21I, V35I, T39A, K43E, E44D, K49R, K101Q, V118I, K122E, E169D, G196E, D218E E53DH
>pt27-t0| codons 1-230
PISPIETVPVKLKPGMDGPKIKQWPLTEEKIKALIEICAELEEDGKISRIGPHNPYNTPV
FAIKKKNSTKWRKLMDLRELNKRTQDFWEVQLGIPHPAGLQKKKSVTVLDVGDAYFSIPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILDPFRKQNPDIVI
YQYVDDLYVGSDLEIEQHRTKIEELRQHLWRWGFYTPEKKHQKEPPFLWM

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, V82A L24I L10I, K20R, E35D, M36I, N37D, I62IV, L63P, I64IL, A71V  
>pt27-t0| codons 1-99
PQITLWQRPIVTIKIGGQLREALIDTGADDTVLEDIDLPGRWKPKMIGGIGGFVKVRQYD
QVPLEICGHKVIGTVLVGPTPANIIGRNLLTQIGCTLNF

References
Author Title Citation
Romano, L Treatment with lopinavir/ritonavir in heavily pretreated subjects failing multiple antiretroviral regimens in clinical practice. JAIDS, 2002
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005