<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
MZ-pt27 pt27-t0 Italy 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT NA
2 AZT+ DDC NA
3 3TC+ AZT+ RTV NA
4 3TC+ AZT+ IDV NA
5 D4T+ EFV+ NFV NA
6 3TC+ AZT+ RTV+ SQV NA
7 3TC+ AZT+ IDV NA
8 ABC+ AZT+ DDI NA
9 ABC+ AZT+ DDC NA
10 3TC+ ABC+ AZT NA
11 APV+ D4T+ DDC+ RTV NA
12 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, V82A L24I L10I, K20R, E35D, M36I, N37D, I62IV, L63P, I64IL, A71V  
>pt27-t0| codons 1-99
PQITLWQRPIVTIKIGGQLREALIDTGADDTVLEDIDLPGRWKPKMIGGIGGFVKVRQYD
QVPLEICGHKVIGTVLVGPTPANIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, M184V, L210W, T215Y V75M, F77L     V21I, V35I, T39A, K43E, E44D, K49R, K101Q, V118I, K122E, E169D, G196E, D218E E53DH
>pt27-t0| codons 1-230
PISPIETVPVKLKPGMDGPKIKQWPLTEEKIKALIEICAELEEDGKISRIGPHNPYNTPV
FAIKKKNSTKWRKLMDLRELNKRTQDFWEVQLGIPHPAGLQKKKSVTVLDVGDAYFSIPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILDPFRKQNPDIVI
YQYVDDLYVGSDLEIEQHRTKIEELRQHLWRWGFYTPEKKHQKEPPFLWM

References
Author Title Citation
Romano, L Treatment with lopinavir/ritonavir in heavily pretreated subjects failing multiple antiretroviral regimens in clinical practice. JAIDS, 2002
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005