<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
MZ-pt26 pt26-t1 Italy 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT NA
2 DDI NA
3 AZT+ DDC NA
4 AZT+ DDC+ RTV NA
5 3TC+ D4T+ SQV NA
6 EFV+ IDV+ NFV NA
7 3TC+ ABC+ LPV NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
G48V, I54A, V82A L33F L10I, K14I, I15V, G16E, L19Q, K20M, E35D, M36I, N37D, I62V, L63C, I64V, T74A, I85V  
>pt26-t1| codons 1-99
PQITLWQRPIVTIIVEGQQMEALLDTGADDTVFEDIDLPGRWKPKMIVGIGGFAKVRQYD
QVCVEICGHKAIGAVLVGPTPANIVGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, T69D, K70R, M184V, T215F K219Q     K122E, G196E, E203K, Q207E, H208Y, K223Q  
>pt26-t1| codons 1-230
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKNSDRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIEQHRTKIKELREYLLRWGFFTPDQKHQQEPPFLWM

References
Author Title Citation
Romano, L Treatment with lopinavir/ritonavir in heavily pretreated subjects failing multiple antiretroviral regimens in clinical practice. JAIDS, 2002
Gonzales, MJ Protease and reverse transcriptase mutation patterns in HIV-1 isolates from heavily treated persons: Comparison of isolates from northern California with isolates from other regions. ARHR, 2003
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005