<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
MZ-pt26 pt26-t0 Italy 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT NA
2 DDI NA
3 AZT+ DDC NA
4 AZT+ DDC+ RTV NA
5 3TC+ D4T+ SQV NA
6 EFV+ IDV+ NFV NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    Q7R, K14V, L19Q, L63C L24LV
>pt26-t0| codons 1-99
PQITLWRRPLVTIVIGGQQKEALVDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QICIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67DN, T69TADN, K70KR T215TILP K103KN V108VI V8I, R83RK, K122KE, Q207E, H208Y  
>pt26-t0| codons 1-230
PISPIETIPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKNSNRWRKLVDFRELNKKTQDFWEVQLGIPHPAGLKKNKSVTILDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELREYLLRWGFPTPDKKHQKEPPFLWM

References
Author Title Citation
Romano, L Treatment with lopinavir/ritonavir in heavily pretreated subjects failing multiple antiretroviral regimens in clinical practice. JAIDS, 2002
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005