<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
MZ-pt41 pt41-t1 Italy 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT NA
2 AZT+ DDI NA
3 3TC+ AZT NA
4 3TC+ D4T+ IDV NA
5 D4T+ DDI+ IDV+ RTV NA
6 3TC+ D4T+ IDV+ RTV NA
7 EFV+ IDV+ RTV NA
8 3TC+ AZT+ LPV NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, M184V, L210W, T215Y       V35I, E44D, A98S, K101Q, K122E, D123E, N175NY, D177DG, G196GE, R211K  
>pt41-t1| codons 1-230
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALIEICTELEKDGKISKIGPENPYNTPV
FAIKKKNSDKWRKLVDFRELNKRTQDFWEVQLGIPHPSGLQKKKSVTVLDVGDAYFSVPL
DEEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQYPGIVI
YQYVDDLYVGSDLEIEQHRTKIEELRQHLWKWGFYTPDKKHQKEPPFLWM

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, V82A, L90M G73S L10I, I15V, L19V, K20I, L24F, M36I, L63P, H69K, A71V, I93L  
>pt41-t1| codons 1-99
PQITLWQRPIVTIKVGGQVIEALFDTGADDTVLEEINLPGRWKPKIIGGIGGFVKVRQYD
QIPIEICGKKVISTVLVGPTPANIIGRNLMTQLGCTLNF

References
Author Title Citation
Romano, L Treatment with lopinavir/ritonavir in heavily pretreated subjects failing multiple antiretroviral regimens in clinical practice. JAIDS, 2002
Gonzales, MJ Protease and reverse transcriptase mutation patterns in HIV-1 isolates from heavily treated persons: Comparison of isolates from northern California with isolates from other regions. ARHR, 2003
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005