<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
MZ-pt24 pt24-t1 Italy 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+ AZT NA
2 3TC+ AZT+ RTV NA
3 D4T+ DDI+ RTV+ SQV NA
4 D4T+ EFV+ NFV NA
5 3TC+ D4T+ LPV NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, M184MV, T215Y   K101P, K103KN   K43KN, D123E, F214FL R83RS
>pt24-t1| codons 1-230
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELENEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKSTQDFWEVQLGIPHPAGLPKNKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRTKIEELRQHLLRWGLYTPDKKHQKEPPFLWM

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, V82VAFS, L90LM   K20KR, E35D, M36I, L63P, K70R, A71V, I72V  
>pt24-t1| codons 1-99
PQITLWQRPLVTIKIGGQLREALLDTGADDTVLEDINLPGRWKPKMIGGIGGFVKVRQYD
QIPIEICGHRVVGTVLVGPTPSNIIGRNLMTQIGCTLNF

References
Author Title Citation
Romano, L Treatment with lopinavir/ritonavir in heavily pretreated subjects failing multiple antiretroviral regimens in clinical practice. JAIDS, 2002
Gonzales, MJ Protease and reverse transcriptase mutation patterns in HIV-1 isolates from heavily treated persons: Comparison of isolates from northern California with isolates from other regions. ARHR, 2003
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005