<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
MZ-pt40 pt40-t0 Italy 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT NA
2 AZT+ DDC NA
3 3TC+ AZT NA
4 3TC+ AZT+ SQV NA
5 3TC+ AZT+ RTV NA
6 D4T+ DDI+ NFV NA
7 D4T+ NVP+ RTV+ SQV NA
8 ABC+ APV+ D4T NA
9 ABC+ D4T+ RTV+ SQV NA
10 ABC+ D4T NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I84V, L90M F53FL I15V, G16E, K20I, Q61H, L63S, H69K, A71V, V77I, I85V  
>pt40-t0| codons 1-99
PQITLWQRPLVTIKVEGQLIEALLDTGADDTVLEEMNLPGRWKPKIIGGIGGLIKVRQYD
HISIEICGKKVIGTVLIGPTPVNVVGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L210W, T215Y V75M, F77FL, K219KR   K101KHNQ V35L, K43Q, E44D, L109I, V118I, K122E, D123E, I135T, G196E, H208Y, D218E  
>pt40-t0| codons 1-230
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALLEICTELEQDGKISKIGPENPYNTPV
FAIKKKNSTKWRKLMDLRELNKRTQDFWEVQLGIPHPAGLQKKKSVTVIDVGDAYFSIPL
DEEFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIEQHRTKIEELRQYLWRWGFYTPERKHQKEPPFLWM

References
Author Title Citation
Romano, L Treatment with lopinavir/ritonavir in heavily pretreated subjects failing multiple antiretroviral regimens in clinical practice. JAIDS, 2002
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005