<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
MZ-pt21 pt21-t0 Italy 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+ AZT+ SQV NA
2 3TC+ AZT+ IDV NA
3 3TC+ AZT+ EFV+ NFV NA
4 D4T+ EFV+ NFV NA
5 D4T+ DDI+ NFV NA
6 None NA
7 D4T+ DDI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, Q151M T215I, K219E Y188L   T39TA, K64R, K122E, I135T, S162C, R172K  
>pt21-t0| codons 1-230
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICAEMEKEGKISKIGPENPYNTPV
FAIRKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSTNNETPGIRYQYNVLPMGWKGSPAIFQCSMTKILEPFKKQNPDIVI
YQYMDDLLVGSDLEIGQHRTKIEELRQHLLRWGFITPDEKHQKEPPFLWM

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
L90M G73S L10I, T12N, I15V, L19I, R41K, L63P, V77VI, I93L  
>pt21-t0| codons 1-99
PQITLWQRPIVNIKVGGQIKEALLDTGADDTVLEEMNLPGKWKPKMIGGIGGFIKVRQYD
QIPIEICGHKAISTVLIGPTPVNIIGRNLMTQLGCTLNF

References
Author Title Citation
Romano, L Treatment with lopinavir/ritonavir in heavily pretreated subjects failing multiple antiretroviral regimens in clinical practice. JAIDS, 2002
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005