<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
MZ-pt20 pt20-t1 Italy 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT NA
2 AZT+ DDI NA
3 AZT+ DDC+ SQV NA
4 3TC+ AZT+ SQV NA
5 3TC+ D4T+ RTV NA
6 D4T+ RTV+ SQV NA
7 D4T+ DDI+ EFV+ NFV NA
8 D4T+ DDI+ IDV+ RTV NA
9 D4T+ DDI+ LPV NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, G48V, I54V, V82A, L90M   L10I, L63P, I64L, A71I, V77I, I93L  
>pt20-t1| codons 1-99
PQITLWQRPIVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKLIVGIGGFVKVRQYD
QIPLEICGHKIIGTVLIGPTPANIIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, L210W, T215Y K219R K103N V108I S48T, V118I, K122E, I135T, S162C, I178M, G196E, T200I, E203K, R211K, K223E  
>pt20-t1| codons 1-230
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKITKIGPENPYNTPV
FAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTILDVGDAYFSIPL
DEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPDMVI
YQYMDDLYVGSDLEIEQHRIKIKELRQHLWKWGFYTPDRKHQEEPPFLWM

References
Author Title Citation
Romano, L Treatment with lopinavir/ritonavir in heavily pretreated subjects failing multiple antiretroviral regimens in clinical practice. JAIDS, 2002
Gonzales, MJ Protease and reverse transcriptase mutation patterns in HIV-1 isolates from heavily treated persons: Comparison of isolates from northern California with isolates from other regions. ARHR, 2003
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005