<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1264 CA3036 U.S. 1997 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT 17
2 3TC+AZT+SQV 70
3 3TC+AZT+NFV 18

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N, L90M K43T I13V, I15V, K20T, E35D, M36MI, L63P, I64V, T91TI  
>CA3036| codons 1-99
PQITLWQRPLVTVKVGGQLTEALLDTGADNTVLEDINLPGRWTPKMIGGIGGFIKVRQYD
QIPVEICGHKAIGTVLVGPTPVNIIGRNLMIQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V L74LF     V35R, T69TS, R83K, L100LF, I135V, Q207E, V245E, A272P, K277R, T286A, E297K R72RG, N81NY, Q85QP
>CA3037| codons 1-303
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALREICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSSKWGKFVDFRELYKKTPDFWEVQLGIPHPAGFKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRTKIEELREHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIELPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGAKALTEVIPLTKEAE
LEL

References
Author Title Citation
Zolopa, AR HIV-1 genotypic resistance patterns predict response to saquinavir/ritonavir in patients in whom previous protease inhibitor therapy failed. Ann Intern Med, 1999
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005