<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
MZ-pt38 pt38-t1 Italy 2001 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 52
2 DDI 52
3 D4T+DDI 52
4 D4T 52
5 D4T+RTV 52
6 3TC+D4T+IDV 52
7 D4T+DDI+NFV 104
8 3TC+ABC+APV 52
9 D4T+DDI+LPV+NVP 52

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, M46I, I47V, I54M, V82A, L90M L33F, K43T, G73S, L89V I15V, K20R, E35D, M36I, N37E, K55R, R57K, L63P, A71V, I93L  
>pt38-t1| codons 1-99
PQITLWQRPLVTIKVGGQLREALLDTGADDTIFEDIELPGRWTPKIVGGIGGFMRVKQYD
QIPIEICGHKVISTVLVGPTPANIIGRNVMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K65R, Q151M V75I, F77L, F116Y Y181CF   V35I, S68G, E79D, R83K, V118I, D121Y, K122E, S162C, S163A, I178M, Q197E, T200A, R211AT, F214L  
>pt38-t1| codons 1-230
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALIEICTEMEKEGKISKIGPENPYNTPV
FAIKRKDGTKWRKLIDLRDLNKKTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYYSIPL
YEDFRKYTAFTIPSINNETPGIRYQYNVLPMGWKGSPAIFQCAMTKILEPFRKQNPDMVI
FQYMDDLYVGSDLEIGEHRAKIEELRQHLLTWGLTTPDKKHQKEPPFLWM

References
Author Title Citation
Romano, L Treatment with lopinavir/ritonavir in heavily pretreated subjects failing multiple antiretroviral regimens in clinical practice. JAIDS, 2002
Gonzales, MJ Protease and reverse transcriptase mutation patterns in HIV-1 isolates from heavily treated persons: Comparison of isolates from northern California with isolates from other regions. ARHR, 2003
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005