<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
MZ-pt37 pt37-t0 Italy 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT NA
2 AZT+ DDI NA
3 AZT+ DDC NA
4 3TC+ D4T+ IDV NA
5 D4T+ IDV+ NVP NA
6 D4T+ NFV+ NVP+ SQV NA
7 D4T+ EFV+ IDV+ RTV NA
8 APV+ D4T+ DDI+ RTV NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, L90M L10F, G73T E35D, N37D, I62V, L63P, I64V, A71V, P79A, Q92K  
>pt37-t0| codons 1-99
PQITLWQRPFVTIKIGGQLKEALLDTGADDTVLEDMDLPGRWKPKIIGGIGGFIKVRQYD
QVPVEICGHKVITTVLVGATPVNIIGRNLMTKIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, T69S_SS, L74V, L210W, T215Y   K103N, Y181C, G190A V108VI V35I, W88C, V118I, K122E, T139K, F171Y, R211K, H221Y  
>pt37-t0| codons 1-230
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALIEICTELEKEGKISKIGPENPYNTPV
FAIKKKDSSKWRKVVDFRELNKRTQDFCEVQLGIPHPAGLKKNKSVTILDVGDAYFSIPL
DEDFRKYTAFTIPSINNEKPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPYRKQNPDIVI
CQYMDDLYVASDLEIGQHRTKIEELRQHLWKWGFYTPDKKYQKEPPFLWM

References
Author Title Citation
Romano, L Treatment with lopinavir/ritonavir in heavily pretreated subjects failing multiple antiretroviral regimens in clinical practice. JAIDS, 2002
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005