<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
11482 11482 Thailand 2013 HIV1 CRF01_AE Plasma None

Treatment History
Order Regimen Weeks
1 3TC+NVP+TDF NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K65R, M184I   Y181CG   V35T, T39K, K43A, V60I, S68G, K102Q, K103R, I135T, K166R, K173I, Q174R, D177E, I178IM, V179T, T200A, Q207A, R211S, V245E E79EV
>11482| codons 20-264
KVKQWPLTEEKIKALTEICKEMEAEGKISKIGPENPYNTPIFAIKRKDGTKWRKLVDFRV
LNKRTQDFWEVQLGIPHPAGLKQRKSVTVLDVGDAYFSVPLDKDFRKYTAFTIPSTNNET
PGIRYQYNVLPQGWKGSPAIFQSSMTRILEPFRIRNPEMTIGQYIDDLYVGSDLEIGQHR
AKIEELRAHLLSWGFTTPDKKHQKEPPFLWMGYELHPDKWTVQPIELPEKDSWTVNDIQK
LVGKL

References
Author Title Citation
Rhee, SY Mutational Correlates of Virological Failure in Individuals Receiving a WHO-Recommended Tenofovir-Containing First-Line Regimen: An International Collaboration. EBioMedicine, 2017