<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12081 12081 Thailand 2014 HIV1 CRF01_AE Plasma None

Treatment History
Order Regimen Weeks
1 3TC+EFV+TDF NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
L74I, Y115F, M184V   V106M V179D, F227L K22R, V35T, T39K, K43E, S68G, K103R, K122E, D123S, T165TI, K173I, Q174K, D177E, I178L, T200R, Q207A, R211S, V245E, D250E  
>12081| codons 20-255
KVRQWPLTEEKIKALTEICKEMEEEGKISKIGPENPYNTPVFAIKKKDGTKWRKIVDFRE
LNKRTQDFWEVQLGIPHPAGLKKRKSMTVLDVGDAFFSVPLDESFRKYTAFTIPSINNET
PGIRYQYNVLPQGWKGSPAIFQSSMIKILEPFRIKNPELDIYQYVDDLYVGSDLEIGQHR
RKIEELRAHLLSWGFTTPDKKHQKEPPLLWMGYELHPDKWTVQPIELPEKESWTVN

References
Author Title Citation
Rhee, SY Mutational Correlates of Virological Failure in Individuals Receiving a WHO-Recommended Tenofovir-Containing First-Line Regimen: An International Collaboration. EBioMedicine, 2017