<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
9571 9571 Thailand 2012 HIV1 CRF01_AE Plasma None

Treatment History
Order Regimen Weeks
1 3TC+EFV+TDF NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
      V179D V35T, T39K, K43E, V60I, S68G, K103R, K122E, D123S, I135R, K173I, Q174K, D177E, Q207A, R211S, F214L, V245E  
>9571| codons 20-263
KVKQWPLTEEKIKALTEICKEMEEEGKISKIGPENPYNTPIFAIKKKDGTKWRKLVDFRE
LNKRTQDFWEVQLGIPHPAGLKKRKSVTVLDVGDAYFSVPLDESFRKYTAFTIPSRNNET
PGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRIKNPEIDIYQYMDDLYVGSDLEIGQHR
TKIEELRAHLLSWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIELPEKDSWTVNDIQK
LVGK

References
Author Title Citation
Rhee, SY Mutational Correlates of Virological Failure in Individuals Receiving a WHO-Recommended Tenofovir-Containing First-Line Regimen: An International Collaboration. EBioMedicine, 2017