<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1251 CA3008 U.S. 1997 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 52
2 AZT+DDC 26
3 AZT+DDI 65
4 3TC+AZT+D4T 39
5 3TC+D4T+DDI 17
6 3TC+D4T+DDI+SQV 13
7 3TC+RTV+SQV 17
8 3TC+NVP 26
9 3TC+AZT+IDV 8
10 3TC+D4T+RTV+SQV 9
11 3TC+D4T+NVP+RTV+SQV 29

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, M184V, T215F K219E Y188L   T69N, K122E, V245R  
>CA3008| codons 1-261
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKNSNRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLLVGSDLEIGQHRTKIEELRQHLLRWGFFTPDEKHQKEPPFLWMGYELHPDKWT
VQPIRLPEKDSWTVNDIQKLV

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46MI, I84IV, L90M N88ND L10I, I13IV, K20KR, E35D, M36I, R41RK, L63P, A71AV  
>CA3011| codons 1-99
PQITLWQRPIVTVKIGGQLREALLDTGADDTVLEDINLPGKWKPKIIGGIGGFIKVRQYD
QIPIEICGHKVIGTVLVGPTPVNVIGRDLMTQIGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005