<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
RP129 RP129 South Africa 2011 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 3TC+D4T+LPV 107

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V       V35T, E36A, T39E, S48T, A98S, K122E, K173A, Q174K, D177G, T200A, I202V, Q207V, R211K, V245Q, A272P, T286A, V292I, I293V, E300EK  
>RP129| codons 1-304
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTAICEEMEKEGKITKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPSGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRAKNPGIVI
YQYVDDLYVGSDLEIGQHRAKVEELRVHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGAKALTEIVPLTEEAK
LELA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12S, I15V, L19I, K20R, E35D, M36I, R41K, H69K, T74S, L89M, I93L  
>RP129| codons 1-99
PQITLWQRPLVSIKVGGQIREALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYD
QILIEICGKKAIGSVLVGPTPVNIIGRNMLTQLGCTLNF

References
Author Title Citation
Rossouw, TM Factors associated with the development of drug resistance mutations in HIV-1 infected children failing protease inhibitor-based antiretroviral therapy in South Africa. PLoS ONE, 2015