<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
RP104 RP104 South Africa 2010 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 3TC+D4T+LPV 124

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V     E138K V35T, E36A, T39E, S48T, A98S, K103KE, K122E, K173A, Q174K, D177DE, V179I, Q197QR, T200A, I202IV, E203ED, Q207N, R211KT, F214FL, V245Q, A272P, K277R, L283I, I293V, E297EK, L303LW, Q334H, G335D, R356K, G359T, A371AV, T377Q, T386TI, K390R, A400L, E404D, V435A K30KT
>RP104| codons 1-447
PISPIETVPVKLKPGMDGPKVKQWPLTEETIKALTAICEEMEKEGKITKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPSGLKKEKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNKTPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRAKNPEIII
YQYVDDLYVGSDLEIGRHRAKVDELRNHLLTWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLIRGTKALTEVVPLTKEAE
LEWAENREILKEPVHGVYYDPSKDLIAEIQKQGHDQWTYQIYQEPFKNLKTGKYAKMRTA
HTNDVKQLTEVVQKIAQESIVIWGKIPKFRLPIQKETWELWWTDYWQATWIPEWEFVNTP
PLVKLWYQLEKEPIAGAETFYVDGAAN

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I50V, I54V, V82A   L10I, T12S, I15V, L19V, K20R, E35D, M36I, R41K, L63P, H69K, K70R, A71V, V77I, L89M, I93L T31TI
>RP104| codons 1-99
PQITLWQRPIVSIKVGGQVREALLDTGADDIVLEDINLPGKWKPKIIGGVGGFVKVRQYD
QIPIEICGKRVIGTVLIGPTPANIIGRNMLTQLGCTLNF

References
Author Title Citation
Rossouw, TM Factors associated with the development of drug resistance mutations in HIV-1 infected children failing protease inhibitor-based antiretroviral therapy in South Africa. PLoS ONE, 2015