<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
RP112-3 RP112-3 South Africa 2012 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 3TC+D4T+RTV 23
2 3TC+D4T+LPV 237

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V       V21VI, T27TS, V35T, E36A, T39E, S48T, V90VI, A98S, K122E, D123G, S162A, K173A, Q174QK, D177E, I178IL, V179VI, G196K, T200A, I202V, Q207E, R211A, V245Q, T286A, V292I, I293V, E300EK E302K
>RP112-3| codons 1-302
PISPIETVPVKLKPGMDGPKIKQWPLSEEKIKALTAICEEMEKEGKITKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEIQLGIPHPSGLKKKKSVTVLDVGDAYFSVPL
DEGFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQASMTKILEPFRAKNPELII
YQYVDDLYVGSDLEIKQHRAKVEELREHLLAWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGAKALTEIVPLTEEAK
LK

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54IV, V82VA L10LF T12S, K14R, I15V, L19I, K20R, E35D, M36L, R41K, Q61H, L63P, H69K, V77I, L89M, I93L  
>RP112-3| codons 1-99
PQITLWQRPFVSIRVGGQIREALLDTGADDTVLEDLNLPGKWKPKMIGGIGGFVKVRQYD
HIPIEICGKKAIGTVLIGPTPANIIGRNMLTQLGCTLNF

References
Author Title Citation
Rossouw, TM Factors associated with the development of drug resistance mutations in HIV-1 infected children failing protease inhibitor-based antiretroviral therapy in South Africa. PLoS ONE, 2015