<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
SE602020 SE602020 Sweden 2011 HIV1 CRF02_AG Plasma None

Treatment History
Order Regimen Weeks
1 NNRTI+NRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V   V106A F227L P4S, V35T, T39A, E53D, S68G, A98S, D123E, I135V, S162A, K173A, Q174K, D177E, T200A, Q207E, R211K, F214L, D237N, V245Q, E248D, A272P, V292I, I293V, P294T, S322T, G335D, R356K, M357K, G359S, K366R, A371V, I375V, K390R, A400T, T403M, E432D, R448K, V467I, D471E, Q480H, L491S, K512R, S519N, Q524K, K527Q, E529D, A534S, A554N  
>SE602020| codons 1-560
PISSIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICAEMEKEGKISKIGPDNPYNTPV
FAIKKKDGTKWRKLVDFRELNKRTQDFWEVQLGIPHPSGLKKKKSATVLDVGDAYFSVPL
DKEFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQASMTKILEPFRAKNPEIVI
YQYVDDLYVGSDLEIGQHRAKIEELREHLLKWGLTTPDKKHQKEPPLLWMGYELHPNKWT
VQPIQLPDKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKALTEIVTLTEEAE
LELAENREILKEPVHGVYYDPTKDLIAEIQKQGQDQWTYQIYQEPFKNLKTGKYAKKRSA
HTNDVRQLTEVVQKVATESIVIWGKTPKFRLPIQKETWETWWMEYWQATWIPEWEFVNTP
PLVKLWYQLEKDPIVGAETFYVDGAANKETKLGKAGYVTDRGRQKVISLTETTNQKTELH
AIHLALQDSGSEVNIVTDSQYALGIIQAQPDRSESELVNQIIEKLIQKDKVYLSWVPAHK
GIGGNEQVDKLVSNGIRKVL

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
  L10F I13V, K14R, K20I, M36I, N37D, R41K, K43KR, H69K, K70KR, L89M  
>SE602020| codons 1-99
PQITLWQRPFVTVRIGGQLIEALLDTGADDTVLEEIDLPGKWRPKMIGGIGGFIKVRQYD
QILIEICGKRAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
    K14R, R20K, V31I, L101I, T112V, T124A, T125A, G134D, I135V, K136T, V201I, T206S, N222K, L234I, R269K S283G
>SE602020| codons 1-288
FLDGIDKAQEEHERYHSNWKAMASDFNLPPIVAKEIVASCDKCQLKGEAMHGQVDCSPGI
WQLDCTHLEGKIILVAVHVASGYIEAEVIPAETGQETAYFILKLAGRWPVKVIHTDNGSN
FTSAAVKAACWWADVTQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIIDIIASDIQTKELQKQITKIQKFRVYYRDSRDPIWKGPAK
LLWKGEGAVVIQDNSDIKVVPRRKAKIIKDYGKQMAGDDCVAGRQDED

References
Author Title Citation
Grossmann, S Subtype-independent near full-length HIV-1 genome sequencing and assembly to be used in large molecular epidemiological studies and clinical management. J Int AIDS Soc, 2015