<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
AR05-1056 AR05-1056 Belgium 2005 HIV1 CRF02_AG Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
    K14KR, D25E, V31I, L101I, K111KT, T112V, S119SG, T122TI, T124N, T125A, G134N, I135V, E157Q, K160Q, F181L, K188KR, V201I, T206S, T218I, N222NH, L234I, D256E, A265V S283G
>AR05-1056| codons 1-288
FLDGIDKAQEEHERYHSNWRAMASEFNLPPIVAKEIVASCDKCQLKGEAMHGQVDCSPGI
WQLDCTHLEGKIILVAVHVASGYIEAEVIPAETGQETAYFILKLAGRWPVTVIHTDNGGN
FISNAVKAACWWANVKQEFGIPYNPQSQGVVESMNKQLKQIIGQVRDQAEHLKTAVQMAV
LIHNFKRRGGIGGYSAGERIIDIIASDIQTKELQKQIIKIQHFRVYYRDSRDPIWKGPAK
LLWKGEGAVVIQDNSEIKVVPRRKVKIIRDYGKQMAGDDCVAGRQDED

References
Author Title Citation
Van Laethem, K A genotypic assay for the amplification and sequencing of integrase from diverse HIV-1 group M subtypes. J Virol Methods, 2008