<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
92NG003 92NG003 Nigeria 1992 HIV1 G PBMC Unknown

Treatment History
Order Regimen Weeks
1 None NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, E40D, V60I, K104R, V118I, K122E, D123N, K173T, Q174E, D177E, I195T, T200A, Q207N, V245Q, E248N, D250E, A272P, T286A, E291D, V292I, I293V, D324E, I329L, Q334C, G335D, F346Y, R356K, M357R, R358G, G359S, T386V, Q394R, A400V, E413D, Q428R, K431T, V435P, F440Y, R448K, R463K, V466I, V467I, S468T, L469I, T470Q, D471E, Q480H, H483Q, L491S, K512R, S519N, A534T, A554S M16I
>92NG003| codons 1-560
PISPIETVPVKLKPGIDGPKVKQWPLTEEKIKALTEICTDMEKEGKISKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKRSVTVLDVGDAYFSIPL
DENFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRTENPEIVI
YQYMDDLYVGSDLETGQHRAKIEELRNHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPNKESWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGAKALTDIVPLTEEAE
LELAENREILKEPVHGVYYDPSKELIAELQKQGCDQWTYQIYQEPYKNLKTGKYAKRGSA
HTNDVKQLTEAVQKIATESIVIWGKVPKFKLPIRKETWEVWWTEYWQATWIPDWEFVNTP
PLVKLWYRLETEPIPGAETYYVDGAANKETKLGKAGYVTDRGKQKIITIQETTNQKTELH
AIQLALQDSGSEVNIVTDSQYALGIIQAQPDRSESELVNQIIEQLIKKEKVYLTWVPAHK
GIGGNEQVDKLVSSGIRKVL

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, K14R, K20I, E35Q, M36I, R41K, R57K, C67E, H69K, V82I, L89M  
>92NG003| codons 1-99
PQITLWQRPLVTVRIGGQLIEALLDTGADDTVLEQINLPGKWKPKMIGGIGGFIKVKQYD
QILIEIEGKKAIGTVLVGPTPINIIGRNMLTQIGCTLNF

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
    E11D, K14R, V31I, I72V, L74I, T112V, T124A, T125A, V126M, G134N, K136Q, V201I, T206S, T218I, L234I, D256E, A265V, R269K, D278G S283G
>92NG003| codons 1-288
FLDGIDKAQEDHERYHSNWRAMASDFNLPPIVAKEIVASCDKCQLKGEAMHGQVDCSPGI
WQLDCTHLEGKVIIVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKVIHTDNGSN
FTSAAMKAACWWANIQQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIIDIIASDIQTKELQKQIIKIQNFRVYYRDSRDPIWKGPAK
LLWKGEGAVVIQDNSEIKVVPRRKVKIIKDYGKQMAGGDCVAGRQDED

References
Author Title Citation
Gao, F A comprehensive panel of near-full-length clones and reference sequences for non-subtype B isolates of human immunodeficiency virus type 1. J Virol, 1998