<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
94UG114 94UG114 Uganda 1994 HIV1 D PBMC Unknown

Treatment History
Order Regimen Weeks
1 None NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L       V35I, T39S, V60I, D121H, K122E, I135T, D177E, I178M, V179I, T200I, Q207G, R211K, H221Y, V245H, D250E, A272P, K277R, L282C, T286A, E297A, V317A, G335D, P345Q, F346Y, R356K, A360T, T377Q, S379C, K390R, A400T, F416Y, L452I, H483N, L517V, A534S, A554N, V559I  
>94UG114| codons 1-560
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALIEICSELEKEGKISKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
HEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPEMII
YQYMDDLYVGSDLEIGQHRIKIEELRGHLLKWGFTTPDKKYQKEPPFLWMGYELHPDKWT
VQPIHLPEKESWTVNDIQKLVGKLNWASQIYPGIKVRQLCKCLRGAKALTEVIPLTAEAE
LELAENREILKEPVHGAYYDPSKDLIAEIQKQGQDQWTYQIYQEQYKNLKTGKYAKMRGT
HTNDVKQLTEAVQKIAQECIVIWGKTPKFRLPIQKETWETWWTEYWQATWIPEWEYVNTP
PLVKLWYQLEKEPIVGAETFYVDGAANRETKIGKAGYVTDRGRQKVVSLTDTTNQKTELQ
AINLALQDSGLEVNIVTDSQYALGIIQAQPDKSESEVVSQIIEQLIKKEKVYLSWVPAHK
GIGGNEQVDKLVSNGIRKIL

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10V, I13V, M36I, R41K, L63P, I64L  
>94UG114| codons 1-99
PQITLWQRPVVTVKIGGQLKEALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYD
QIPLEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
    S17N, D25E, L45V, M50L, I72G, T112V, I113V, T124A, T125A, D167E, V201I, T218I, L234V, D256E  
>94UG114| codons 1-288
FLDGIDKAQEEHEKYHNNWRAMASEFNLPPVVAKEIVASCDKCQVKGEALHGQVDCSPGI
WQLDCTHLEGKGILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKVVHTDNGSN
FTSAAVKAACWWAGIKQEFGIPYNPQSQGVVESMNKELKKIIGQVREQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIIDIIATDIQTKELQKQIIKIQNFRVYYRDSRDPVWKGPAK
LLWKGEGAVVIQDNSEIKVVPRRKAKIIRDYGKQMAGDDCVASRQDED

References
Author Title Citation
Gao, F A comprehensive panel of near-full-length clones and reference sequences for non-subtype B isolates of human immunodeficiency virus type 1. J Virol, 1998