<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
TVSP1 TVSP1 Brazil 1999 HIV1 F Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT 43
2 3TC+D4T 22
3 3TC+D4T+RTV 39
4 3TC+D4T+NFV 8

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, M184V, T215F       K22N, V35T, E44K, I135V, S162C, E169A, K173A, Q174K, Q207E, R211K, V245Q, E248D, A272P, T286A, V292I, I293V, E297T  
>TVSP1| codons 1-324
PISPIETVPVKLKPGMDGPKVNQWPLTEEKIKALTEICTELEKKGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILAPFRAKNPDIVI
YQYVDDLYVGSDLEIGQHRTKIEELREHLLKWGFFTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPDKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGAKALTEIVPLTTEAE
LELAENREILKEPVHGVYYDPSKD

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, V82A   T12A, Q18L, L19I, K20R, E35D, M36I, R41K, R57K, Q61H, L63P, I72T  
>TVSP1| codons 1-99
PQITLWQRPLVAIKIGGLIREALLDTGADDTVLEDINLPGKWKPKMIGGIGGFVKVKQYD
HIPIEICGHKATGTVLVGPTPANIIGRNLLTQIGCTLNF

References
Author Title Citation
Brindeiro, PA Testing genotypic and phenotypic resistance in human immunodeficiency virus type 1 isolates of clade B and other clades from children failing antiretroviral therapy. J Clin Microbiol, 2002