<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
TVGG3 TVGG3 Brazil 1999 HIV1 F Plasma None

Treatment History
Order Regimen Weeks
1 AZT 165
2 AZT+DDI 9
3 3TC+AZT 113
4 3TC+D4T+NFV 30

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54IV, V82VA   L10LV, I15V, L19I, E35D, M36I, R41K, R57K, Q61N, L63V, E65D, H69Y, I72T, L89M  
>TVGG3| codons 1-99
PQITLWQRPVVTIKVGGQIKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFVKVKQYD
NIVIDICGYKATGTVLVGPTPANIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, T69D, K70R, M184V K219KQ     K49R, V118I, K122E, I135T, E169D, F214L, V245T, A272P, K281R, T286A, I293V, E297K  
>TVGG3| codons 1-324
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISRIGPENPYNTPV
FAIKKKNSDRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILDPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDQKHQKEPPFLWMGYELHPDKWT
VQPITLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCRLLRGAKALTEVVPLTKEAE
LELAENREILKEPVHGVYYDPSKD

References
Author Title Citation
Brindeiro, PA Testing genotypic and phenotypic resistance in human immunodeficiency virus type 1 isolates of clade B and other clades from children failing antiretroviral therapy. J Clin Microbiol, 2002