<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
TVGG41 TVGG41 Brazil 2000 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 3TC+ AZT 17

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V   P236L   V35T, E36A, T39E, S48T, K122E, D123S, K173A, D177E, T200A, Q207E, R211K, V245Q, A272P, K277R, T286A, E291D, V292I, I293V, P294S Q258L
>TVGG41| codons 1-324
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTAICEEMEKEGKITKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRAQNPEIVI
YQYVDDLYVGSDLEIGQHRAKIEELREHLLKWGFTTPDKKHQKEPPFLWMGYELHLDKWT
VQPIQLPEKDSWTVNDILKLVGKLNWASQIYPGIKVRQLCKLLRGAKALTDIVSLTEEAE
LELAENREILKEPVHGVYYDPSKD

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I15V, M36I, N37K, R41N, R57G, D60E, L63P, H69K, L89M, I93L  
>TVGG41| codons 1-99
PQITLWQRPLVTIKVGGQLKEALLDTGADDTVLEEIKLPGNWKPKMIGGIGGFIKVGQYE
QIPIEICGKKAIGTVLVGPTPVNIIGRNMLTQLGCTLNF

References
Author Title Citation
Brindeiro, PA Testing genotypic and phenotypic resistance in human immunodeficiency virus type 1 isolates of clade B and other clades from children failing antiretroviral therapy. J Clin Microbiol, 2002