<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
TVSP18 TVSP18 Brazil 1999 HIV1 F Plasma None

Treatment History
Order Regimen Weeks
1 AZT 2
2 DDI 68
3 3TC+DDI 17
4 3TC+D4T+RTV 104

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V   L10I, I15V, K20R, E35D, M36I, R41K, Q61D, L63P, I72V R57E
>TVSP18| codons 2-99
QITLWQRPIVTIKVGGQLREALLDTGADDTVLEDINLPGKWKPKMIGGIGGFVKVEQYDD
IPIEICGHKAVGTVLVGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V       E28K, W88S, I135T, T200A, E203K, R211K, F214L, V245D, K277R, A288S, I293V, E297A, S322P  
>TVSP18| codons 1-324
PISPIETVPVKLKPGMDGPKVKQWPLTKEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFSEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRAKIKELRQHLLKWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIDLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVRQLCKLLRGTKSLTEVVPLTAEAE
LELAENREILKEPVHGVYYDPPKD

References
Author Title Citation
Brindeiro, PA Testing genotypic and phenotypic resistance in human immunodeficiency virus type 1 isolates of clade B and other clades from children failing antiretroviral therapy. J Clin Microbiol, 2002