<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
TVGG27 TVGG27 Brazil 1999 HIV1 F Plasma None

Treatment History
Order Regimen Weeks
1 D4T+DDI+RTV 4
2 3TC+D4T+NFV+NVP 26

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, V82A, L90M   L10I, I15V, K20R, E35D, M36I, N37D, R41K, R57K, Q61N, T74S, L89I  
>TVGG27| codons 1-99
PQITLWQRPIVTIKVGGQLREALLDTGADDTVLEDIDLPGKWKPKMIGGIGGFVKVKQYD
NILIEICGHKAIGSVLVGPTPANIIGRNIMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T215Y K70S, V75S V106A, Y181C   V35T, E44D, K122E, E169D, K173T, Q174K, I178L, Q197E, T200A, E203K, Q207A, H208Y, R211K, K223Q, V245Q, E248D, A272P, T286A, E291D, V292I, I293V, E297A N306D
>TVGG27| codons 1-324
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTELEKDGKISKIGPENPYNTPV
FAIKKKNSTSWRKLSDFRELNKRTQDFWEVQLGIPHPAGLKKKKSATVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILDPFRTKNPDLVI
CQYMDDLYVGSDLEIGEHRAKIKELRAYLLKWGFYTPDKKHQQEPPFLWMGYELHPDKWT
VQPIQLPDKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGAKALTDIVPLTAEAE
LELAEDREILKEPVHGVYYDPSKD

References
Author Title Citation
Brindeiro, PA Testing genotypic and phenotypic resistance in human immunodeficiency virus type 1 isolates of clade B and other clades from children failing antiretroviral therapy. J Clin Microbiol, 2002