<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
TVSP15 TVSP15 Brazil 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT 39
2 3TC+AZT+RTV 22
3 3TC+D4T 4
4 3TC+D4T+RTV 35
5 3TC+D4T+NFV 35

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70R, M184V, T215F K219E     I135T, R211K, A272P, K281R, I293V, E297K  
>TVSP15| codons 1-319
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPV
FAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRTKIEELRQHLLKWGFFTPDEKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCRLLRGTKALTEVVPLTKEAE
LELAENREILKEPVHGVYY

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V82L L24I, K43T L10I, E35D, M36I, R41K, R57K, Q61N, L89M  
>TVSP15| codons 1-99
PQITLWQRPIVTIKIGGQLKEALIDTGADDTVLEDINLPGKWTPKMIGGIGGFIKVKQYD
NILIEICGHKAIGTVLVGPTPLNIIGRNMLTQIGCTLNF

References
Author Title Citation
Gonzales, MJ Protease and reverse transcriptase mutation patterns in HIV-1 isolates from heavily treated persons: comparison of isolates from northern California with isolates from other regions. ARHR, 2003
Brindeiro, PA Testing genotypic and phenotypic resistance in human immunodeficiency virus type 1 isolates of clade B and other clades from children failing antiretroviral therapy. J Clin Microbiol, 2002
Rhee, SY HIV-1 Protease and Reverse Transcriptase Mutations: Correlations with Antiretroviral Therapy in Subtype B Isolates and Implications for Drug-Resistance Surveillance. J Infect Dis, 2005